PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.14G073600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family LBD
Protein Properties Length: 291aa    MW: 32632.1 Da    PI: 5.9917
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.14G073600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601292.1e-40101101101
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          aCaaCk++rrkC+++C+lapyfp +qp+ f+n+hklFG+++++kll++l+ ++re+am+s++y+A++r r Pv+G+ g+i +l+ q++q+
  Manes.14G073600.1.p  10 ACAACKYQRRKCSSECPLAPYFPPDQPQLFQNAHKLFGVKKITKLLENLEASQREEAMRSVIYQANVRDRFPVHGCWGIICQLHYQIRQA 99 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkeel 101
                          ++el++++++l
  Manes.14G073600.1.p 100 EEELHAVHAQL 110
                          *******9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.4259110IPR004883Lateral organ boundaries, LOB
PfamPF031953.3E-3810107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MTLKGGTSQA CAACKYQRRK CSSECPLAPY FPPDQPQLFQ NAHKLFGVKK ITKLLENLEA  60
SQREEAMRSV IYQANVRDRF PVHGCWGIIC QLHYQIRQAE EELHAVHAQL EMYRQHQHHQ  120
ISSLTDDVPS QLQLGMAPPS NALSLFGHNA PQPYNSLPLS QQHSYSNSSN AGYSSGYLDS  180
KEHLGNSLWA QQPYASTNNN NNNNNINPMA IQSHFVSSQP LAIQQEVVQD YDEIHPFFDT  240
IDDRQSYIDS KEAYESSSEE SLKDTTQSIE HVAENELKSA AACFSLTSVN *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002511502.11e-173PREDICTED: LOB domain-containing protein 27
SwissprotQ9STS62e-63LBD27_ARATH; LOB domain-containing protein 27
TrEMBLB9R9271e-173B9R927_RICCO; LOB domain-containing protein, putative
STRINGPOPTR_0012s07390.11e-145(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.13e-53LOB domain-containing protein 27